SHERP

Parallel and vertical morphologies in block copolymers of cylindrical domain

Cited 0 time in webofscience Cited 0 time in scopus
Authors
Suh, K. Y.; Kim, Y. S.; Lee, Hong H.
Issue Date
1998-01-15
Publisher
American Institute of Physics
Citation
J. Chem. Phys. 108, 1253 (1998)
Keywords
DIBLOCK COPOLYMERSNEUTRON REFLECTIVITYTHIN-FILMSPHASEMELTS
Abstract
We present a theoretical result on the ordering of cylindrical morphology in diblock and triblock copolymers. The equilibrium morphology of A-B diblock and A-B-A triblock copolymer films is shown to have the cylinders oriented parallel or vertical to the surface, depending on the film thickness and surface tensions. A criterion is derived that can be used to determine the conditions under which the orientation is parallel or vertical.
ISSN
0021-9606
Language
English
URI
http://hdl.handle.net/10371/6255
Files in This Item:
Appears in Collections:
College of Engineering/Engineering Practice School (공과대학/대학원)Dept. of Mechanical Aerospace Engineering (기계항공공학부)Journal Papers (저널논문_기계항공공학부)
  • mendeley

Items in S-Space are protected by copyright, with all rights reserved, unless otherwise indicated.

Browse